BLAST+ executables ; What are the next steps? ; Magic-BLAST ; IgBLAST ; SRPRISM ; Databases
시대는 변한다. 우리의 생활양식도, 문화도, 인간 관계도, 우리가 늘 바라봤던 동네의 풍경도 끊임없이 무언가를 바라본 채로 변화한다. 변화의 과정은 좋을 수도 있고 나쁠 수도 있다. 좋은 방향으로 바뀌는 거라면야 별 말 안 하겠지만 나쁜 방향으로 바뀌게 될 경우라면 '그때가 좋았지'라는 시덥잖은 말을 서로 주고받을 뿐이다. 그렇게 늙어가고, 어느 순간 시대를 따라가는 게 아니라 시대에 휩쓸려가게 된다. 그 ...
the software, BLAST requires a query sequence to search for, and a sequence to search against... In typical usage, the query sequence is much smaller than the database, e.g., the query may
E-value The BLAST E-value is the number of expected hits of similar quality (score) that could be found just by chance. E-value of 10 means that up to 10 hits can be expected to be found just by ch...
ru/projects/blast The Berkeley Lazy Abstraction Software verification Tool (BLAST) is a software model checking tool for C programs. The task addressed by BLAST is the need to check whether...
MMseqs2 Software suite to search and cluster huge sequence sets. Similar sensitivity to BLAST and PSI-BLAST but orders of... Rucci E, García C, Botella G, De Giusti A, Naiouf M, Prieto...
^ a b c d e Smith, G. W. "Aesthetic Wilderness: A Brief Personal History of the Meeting... ^ "Data General Minis Get Blast Software". InfoWorld. March 14, 1988. p. 11. A version of a PC...
Resources ; ElasticBLAST - How to get started with ElasticBLAST. ; ElasticBLAST article - The how and why of ElasticBLAST. ; Database information How to obtain BLAST databases. ; ElasticBLAST github page - Source code for ElasticBLAST.
>P01013 GENE X PROTEIN (OVALBUMIN-RELATED) ; QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE ; KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS
Send bulk emails with our web-based bulk email software, which allows 3rd party Opt-IN email lists. Blast email easily and track your campaigns results.